PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000426.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 337aa    MW: 37414.8 Da    PI: 4.5947
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000426.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.77.3e-26169218352
                   RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              k++s e++s+yF++pi +AAkeL+++lT+LK++CR++GI+RWPhRk+ sl
  Itr_sc000426.1_g00005.1 169 KTLSRETVSNYFYMPISQAAKELNIGLTLLKKRCRELGIRRWPHRKLMSL 218
                              899********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.223147239IPR003035RWP-RK domain
PfamPF020427.5E-21171218IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
METHSSSSSS MYDVKMMPKQ EYGVDFESFT QQIDCPLLDY DYFSGYSEYS LWDYHCGFSM  60
QESPFEASPA AASAMEAPLY SSMDIEQSHN IVQDCNSLWG FGNGLGELNG AISEEFGIGA  120
NDVEAENHTL VSNGGSDNME ISNGSVEDNK KGKKSGSGIG VEEKCCISKT LSRETVSNYF  180
YMPISQAAKE LNIGLTLLKK RCRELGIRRW PHRKLMSLES LIKNVQELGK NQGEGKIREA  240
IKVLENERKL LLRTPDLQLD ETTKRLRQAC FKANYKKRRL VGMVDSSSSS SSNANSSCVP  300
ISTLGYGSRV DDIDDDDEDE EIKSLISDCC PSSSVFL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068UVI12e-79A0A068UVI1_COFCA; Uncharacterized protein
STRINGVIT_17s0000g06250.t011e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.17e-53RWP-RK domain-containing protein